| Entry |
Dermaseptin sI |
| Uniprot code |
Q7T3K6 |
| Fasta |
Q7T3K6 |
| Peptide names |
Dermaseptin-1 Dermaspetin DS S1 DS1 Dermaseptin sI |
| Suborder |
Neobatrachia |
| Family |
Hylidae |
| Genus |
Phyllomedusa |
| Species |
Phyllomedusa sauvagii |
| Ecozone |
Neotropic |
| Distribution |
The Chacoan region of eastern Bolivia, northern Paraguay, Mato Grosso do Sul (Brazil), and northern Argentina |
| Antimicrobial & other activities |
antibacterial, antifungal |
| Tissue |
Skin |
| Sequence |
MDILKKSLFLVLFLGLVSLSICEEEKRENEDEEKQEDDEQSEMKRALWKTMLKKLGTMAL
HAGKAALGAAADTISQGTQ
|
| Length |
79 |
| Signal peptide class |
Class-1 |
| References: |
| 1. for MIC/HC50 |
A. Mor et al. / JBC 269 (1994) 31635-31641. The vertebrate peptide antibiotics dermaseptins have overlapping structural features but target specific microorganisms |