| Entry |
Brevinin-1CDYc |
| Uniprot code |
Q06B79 |
| Fasta |
Q06B79 |
| Peptide names |
Brevinin-1CDYc Brevinin-1DYa |
| Suborder |
Neobatrachia |
| Family |
Ranidae |
| Genus |
Rana |
| Species |
Rana huanrensis |
| Ecozone |
Palearctic |
| Distribution |
Liaoning and Jilin Provinces, China, near the Korean border, and adjacent P.D.R. Korea |
| Antimicrobial & other activities |
antibacterial |
| Tissue |
Skin |
| Sequence |
MFTLKKSLLLIFFLGTINLSLCEEERNADEEERRDDPEERDVEVEKRFLSLALAALPKFL
CLVFKKC
|
| Length |
67 |
| Signal peptide class |
Class-1 |
| Segment type |
Name |
Length |
Amidated |
Sequence |
HC50 (μM) |
MIC E. coli (μM) |
MIC S. aureus (μM) |
| Signal |
|
22 |
|
MFTLKKSLLLIFFLGTINLSLC |
| | |
| Prepro | | 25 | | EEERNADEEERRDDPEERDVEVEKR | | | | | Bioactive | Brevinin-1CDYc | 20 | No | FLSLALAALPKFLCLVFKKC | | | |
|