| Entry | Dermaseptin DS VIII-like peptide |
| Uniprot code | P86280 |
| Fasta | P86280 |
| Peptide names | Dermaseptin DS VIII-like peptide |
| Suborder | Neobatrachia |
| Family | Hylidae |
| Genus | Phyllomedusa |
| Species | Phyllomedusa burmeisteri |
| Ecozone | Neotropic |
| Distribution | Eastern Brazil (Atlantic forest from Sergipe to Sao Paulo), up to 1000 m elevation |
| Antimicrobial & other activities | antibacterial |
| Tissue | Skin |
| Sequence | |
| Length | 33 |
| Segment type | Name | Length | Amidated | Sequence | HC50 (μM) | MIC E. coli (μM) | MIC S. aureus (μM) |
| Bioactive | Dermaseptin DS VIII-like peptide | 33 | Yes | ALWKTMLKKLGTVALHAGKAALGAAADTISQGA |