| Entry |
Kininogen-2 |
| Uniprot code |
P83055 |
| Fasta |
P83055 |
| Peptide names |
Maximakinin Kininogen-2 Bradykinin Maximakinin-associated peptide |
| Suborder |
Archeobatrachia |
| Family |
Bombinatoridae |
| Genus |
Bombina |
| Species |
Bombina maxima |
| Ecozone |
Palearctic, Indomalaya |
| Distribution |
Yunnan, southwestern Sichuan, Hubei, Guizhou, and northern Guangxi, China; adjacent northern Vietnam |
| Antimicrobial & other activities |
contraction of small intestine smooth muscle cells, relaxation of arterial smooth muscle cells |
| Tissue |
Skin |
| Sequence |
MRLWFCLSFFIVLCLEHFPGTLADERNNRDYTIRTRLHGHHKPSRNNRYAIKTSIHGHHI
PRNVPESEEKTEQFLRDLPKINRKGPRPPGFSPFRGKFHSQSLRQIPGLGPLRG
|
| Length |
114 |
| Signal peptide class |
Class-5 |
| References: |
| 2. for other activities |
T. Chen et al. / Peptides 23 (2002) 1547-1555. Bradykinins and their precursor cDNAs from the skin of the fire-bellied toad (Bombina orientalis) |
| Segment type |
Name |
Length |
Amidated |
Sequence |
HC50 (μM) |
MIC E. coli (μM) |
MIC S. aureus (μM) |
| Signal |
|
23 |
|
MRLWFCLSFFIVLCLEHFPGTLA |
| | |
| Prepro | | 53 | | DERNNRDYTIRTRLHGHHKPSRNNRYAIKTSIHGHHIPRNVPESEEKTEQFLR | | | | | Bioactive | Maximakinin | 19 | No | DLPKINRKGPRPPGFSPFR | | | | | Bioactive | Bradykinin | 9 | No | RPPGFSPFR | | | | | Bioactive | Maximakinin-associated peptide | 9 | No | QIPGLGPLR | | | |
|