| Entry | Skin peptide tyrosine-tyrosine |
| Uniprot code | P80952 |
| Fasta | P80952 |
| Peptide names | Skin peptide tyrosine-tyrosine |
| Suborder | Neobatrachia |
| Family | Hylidae |
| Genus | Phyllomedusa |
| Species | Phyllomedusa bicolor |
| Ecozone | Neotropic |
| Distribution | Amazon Basin in Brazil, Colombia, Bolivia, and Peru; the Guianan region of Venezuela and the Guianas. Possibly to be found in eastern Ecuador |
| Antimicrobial & other activities | antibacterial |
| Tissue | Skin |
| Sequence | |
| Length | 36 |
| Segment type | Name | Length | Amidated | Sequence | HC50 (μM) | MIC E. coli (μM) | MIC S. aureus (μM) |
| Bioactive | Skin peptide tyrosine-tyrosine | 36 | Yes | YPPKPESPGEDASPEEMNKYLTALRHYINLVTRQRY |