| Entry | Midkine-A |
| Uniprot code | P48530 |
| Fasta | P48530 |
| Peptide names | Midkine-A MK-A XMK Pleiotrophic factor-alpha-1 PTF-alpha-1 X-PTF-alpha1 |
| Suborder | Mesobatrachia |
| Family | Pipidae |
| Genus | Xenopus |
| Species | Xenopus laevis |
| Ecozone | Afrotropic |
| Distribution | Extreme southern Angola south to Cape Region of Rep. South Africa thence east and north in savanna habitats to north-east-central Central African Republic and southern Sudan and then west to Nigeria; introduced in southern California, Arizona, USA, Mexico, Chile, France, Mexico, Italy, and Java, Indonesia, as well as Ascension Island |
| Tissue | Brain, Eye, Bone, Heart, Lung |
| Sequence | MELRAFCVILLITVLAVSSQAAKNKKEKGKKGASDCTEWTWGSCIPNSKDCGAGTREGTC KEETRKLKCKIPCNWKKAFGADCKYKFENWGECNATTGQKVRSGTLKKALYNADCQQTVE ATKPCSLKTKSKSKGKKGKGKE |
| Length | 142 |
| Signal peptide class | Unclassified |
| Segment type | Name | Length | Amidated | Sequence | HC50 (μM) | MIC E. coli (μM) | MIC S. aureus (μM) |
| Signal | 20 | MELRAFCVILLITVLAVSSQ | |||||
| Prepro | 1 | / | |||||
| Bioactive | Midkine-A | 1 | No | / |