| Entry |
Brevinin-1E |
| Uniprot code |
P32412 |
| Fasta |
P32412 |
| Peptide names |
Brevinin-1E |
| Suborder |
Neobatrachia |
| Family |
Ranidae |
| Genus |
Rana |
| Species |
Pelophylax esculentus |
| Ecozone |
Palearctic |
| Distribution |
Most of western, central and eastern Europe, Denmark and suthern most Sweden, Italy (river Po plain), up to 1550 m elevation. Introduced to United Kingdom and Spain. |
| Antimicrobial & other activities |
antibacterial, antifungal, insulin releasing |
| Tissue |
Skin |
| Sequence |
MFTLKKSMLLLFFLGTINLSLCEEERDADEEERRDNPDESEVEVEKRFLPLLAGLAANFL
PKIFCKITRKC
|
| Length |
71 |
| Signal peptide class |
Class-1 |
| References: |
| 1. for MIC/HC50 |
Mi-Yun Kwon et al. / Biochimica et Biophysica Acta 1387 (1998) 239-248. Structure-activity analysis of brevinin 1E amide, an antimicrobial peptide from Rana esculenta |
| 2. for other activities |
L. Marenah et al. / Journal of Endocrinology 188 (2006) 1-9. Skin secretions of Rana saharica frogs reveal antimicrobial peptides esculentins-1 and -1B and brevinins-1E and -2EC with novel insulin releasing activity |