| Entry |
Esculentin-2ISa |
| Uniprot code |
F1T151 |
| Fasta |
F1T151 |
| Peptide names |
Esculentin-2ISa |
| Suborder |
Neobatrachia |
| Family |
Ranidae |
| Genus |
Odorrana |
| Species |
Odorrana ishikawae |
| Ecozone |
Indomalaya |
| Distribution |
Amami Oshima Island and Okinawa Island, Ryukyu Island, Japan |
| Antimicrobial & other activities |
antibacterial, antifungal |
| Tissue |
Skin |
| Sequence |
MFTLKKSLLLLFFLGTISLSVCKQERDADYEDKGEVEEVKRGIFSLIKGAAKLITKTVAK
EAGKTGLELMACKVTNQC
|
| Length |
78 |
| Signal peptide class |
Class-1 |
| References: |
| 1. for MIC/HC50 |
E. Iwakoshi-Ukena et al. / Peptides 32 (2011) 670-676. Identification and characterization of antimicrobial peptides from the skin of the endangered frog Odorrana ishikawae |