| Entry | Prepropalustrin-2CE |
| Uniprot code | F1AEK7 |
| Fasta | F1AEK7 |
| Peptide names | Prepropalustrin-2CE Palustrin-2CE |
| Suborder | Neobatrachia |
| Family | Ranidae |
| Genus | Rana |
| Species | Rana chensinensis |
| Ecozone | Palearctic |
| Distribution | Eastern Mongolia; north-central China (Shanxi) south to Sichuan and Hubei |
| Antimicrobial & other activities | antibacterial |
| Tissue | Skin |
| Sequence | MFTMKKSMLLLFFLGTISLSLCVQERDADEDEVVEEVRRGLWDSIKNFGKTIALNVMDKI KCKIGGGCPP |
| Length | 70 |
| Signal peptide class | Class-1 |
| References: | |
| 1. for MIC/HC50 | J. Zhao et al. / Zoological Science 28 (2011) 112-117. Molecular Cloning of Novel Antimicrobial Peptide Genes from the Skin of the Chinese Brown Frog, Rana chensinensis; Y. Sun et al. / Bioscience, Biotechnology and Biochemistry 76 (2012) 157-162. Molecular Cloning, Expression, Purification, and Functional Characterization of Palustrin-2CE, an Antimicrobial Peptide of Rana chensinensis |
| Segment type | Name | Length | Amidated | Sequence | HC50 (μM) | MIC E. coli (μM) | MIC S. aureus (μM) |
| Signal | 22 | MFTMKKSMLLLFFLGTISLSLC | |||||
| Prepro | 17 | VQERDADEDEVVEEVRR | |||||
| Bioactive | Palustrin-2CE | 31 | No | GLWDSIKNFGKTIALNVMDKIKCKIGGGCPP | 64 | 12.5 | 50 |