| Entry |
Odorranain-G-RA2 |
| Uniprot code |
E3SZB9 |
| Fasta |
E3SZB9 |
| Peptide names |
Odorranain-G-RA2 Odorranain-G1 |
| Suborder |
Neobatrachia |
| Family |
Ranidae |
| Genus |
Odorrana |
| Species |
Odorrana andersonii |
| Ecozone |
Indomalaya |
| Distribution |
Northeastern India, Upper Myanmar, and northern Thailand to western Yunnan, China; south into Vietnam and Laos |
| Antimicrobial & other activities |
antibacterial |
| Tissue |
Skin |
| Sequence |
MFPLKKPLLLLFFLATINLSLCEEERNAEEERRDDPDEMNAEVEKRFMPILSCSRFKRC
|
| Length |
59 |
| Signal peptide class |
Class-1 |
| References: |
| 1. for MIC/HC50 |
J. Li et al. / Molecular & Cellular Proteomics 6 (2007) 882-894. Anti-infection Peptidomics of Amphibian Skin |