| Entry |
Bradykinin-LF1 |
| Uniprot code |
E1AZ82 |
| Fasta |
E1AZ82 |
| Peptide names |
Bradykinin-LF1 |
| Suborder |
Neobatrachia |
| Family |
Ranidae |
| Genus |
Amolops |
| Species |
Amolops lifanensis |
| Ecozone |
Palearctic |
| Distribution |
Lishan and Maoxian and possibly into Wenchuan counties, central Sichuan, China, 1300-2350 m elevation |
| Tissue |
Skin |
| Sequence |
MFTLKKSLLLLFFLGAISLSLCEQERDADEEETEGGAKVETVKRAPLPPGFTPFRVAPEI
V
|
| Length |
61 |
| Signal peptide class |
Class-1 |
| Segment type |
Name |
Length |
Amidated |
Sequence |
HC50 (μM) |
MIC E. coli (μM) |
MIC S. aureus (μM) |
| Signal |
|
22 |
|
MFTLKKSLLLLFFLGAISLSLC |
| | |
| Prepro | | 22 | | EQERDADEEETEGGAKVETVKR | | | | | Bioactive | Bradykinin-LF1 | 9 | No | LPPGFTPFR | | | |
|