| Entry |
Brevinin-1TOb |
| Uniprot code |
D5MTH3 |
| Fasta |
D5MTH3 |
| Peptide names |
Brevinin-1TOb |
| Suborder |
Neobatrachia |
| Family |
Ranidae |
| Genus |
Rana |
| Species |
Rana tagoi okiensis |
| Ecozone |
Palearctic |
| Distribution |
Mountain regions of Honshu, Shikoku, and Kyushu Islands as well as Togoshima in the Oki Archipelago and Yakushima in the Tanegashima Group, Japan |
| Antimicrobial & other activities |
antibacterial |
| Tissue |
Skin, Brain |
| Sequence |
MFTLKKSMLLLFFLGTISFSLCQEERDANEEEENGGEVKEEEKRVIGSILGVIAKGLPTL
ISWIKNRG
|
| Length |
68 |
| Signal peptide class |
Class-1 |
| Segment type |
Name |
Length |
Amidated |
Sequence |
HC50 (μM) |
MIC E. coli (μM) |
MIC S. aureus (μM) |
| Signal |
|
22 |
|
MFTLKKSMLLLFFLGTISFSLC |
| | |
| Prepro | | 22 | | QEERDANEEEENGGEVKEEEKR | | | | | Bioactive | Brevinin-1TOb | 23 | No | VIGSILGVIAKGLPTLISWIKNR | | | |
|