| Entry |
Nigroain-F |
| Uniprot code |
C0ILA7 |
| Fasta |
C0ILA7 |
| Peptide names |
Nigroain-F Brevinin-2-RN2 |
| Suborder |
Neobatrachia |
| Family |
Ranidae |
| Genus |
Hylarana |
| Species |
Hylarana nigrovittata |
| Ecozone |
Indomalaya |
| Distribution |
Nepal and West Bengal, Assam. and Meghalaya (India) as well as adjacent Bangladesh to Yunnan and Guangxi (China), Vietnam and south to Malaya |
| Antimicrobial & other activities |
antibacterial |
| Tissue |
Skin |
| Sequence |
MFTMKKSLLLLFFLGMISLSFCQDERGADEDDGGEMTEEEKRGAFGNFLKGVAKKAGLKI
LSIAQCKLFGTC
|
| Length |
72 |
| Signal peptide class |
Class-1 |
| References: |
| 1. for MIC/HC50 |
X. Liu et al. / Journal of Peptide Science 17 (2011) 68-72. Two novel antimicrobial peptides from skin secretions of the frog, Rana nigrovittata |