| Entry |
Nigrocin-2 |
| Uniprot code |
B0B2H6 |
| Fasta |
B0B2H6 |
| Peptide names |
Nigrocin-2 Nigrocin-2H Nigrocin-2P |
| Suborder |
Neobatrachia |
| Family |
Ranidae |
| Genus |
Rana |
| Species |
Pelophylax nigromaculatus |
| Ecozone |
Palearctic |
| Distribution |
Lower Amur and Ussuri River valleys (Far East Russia) through northeastern to west-central China, and the Korean Peninsula; Japan (Honshu, Shikoku, and Kyushu), below 2200 m elevation. Isolated populations in eastern Turkmenistan and Yunnan (likely introduced) |
| Antimicrobial & other activities |
antibacterial |
| Tissue |
Skin |
| Sequence |
MFTTKKSILLLFFLGMVSLALCEQERDANEEERRDELDERDVEAIKRGLLSKVLGVGKKV
LCGVSGLC
|
| Length |
68 |
| Signal peptide class |
Class-1 |
| References: |
| 1. for MIC/HC50 |
L. Wang et al. / FEBS Journal 277 (2010) 1519-1531. Nigrocin-2 peptides from Chinese Odorrana frogs - integration of UPLC/MS/MS with molecular cloning in amphibian skin peptidome analysis |