| Entry | Prepromelittin-related peptide |
| Uniprot code | A7BJK6 |
| Fasta | A7BJK6 |
| Peptide names | Prepromelittin-related peptide Melittin-related peptide AR-23 MRP |
| Suborder | Neobatrachia |
| Family | Ranidae |
| Genus | Rana |
| Species | Rana tagoi |
| Ecozone | Palearctic |
| Distribution | Mountain regions of Honshu, Shikoku, and Kyushu Islands as well as Togoshima in the Oki Archipelago and Yakushima in the Tanegashima Group, Japan |
| Antimicrobial & other activities | antibacterial, antifungal |
| Tissue | Skin |
| Sequence | MFTLKKSMLLLFFLGTISFSLCQEERDANEEEENGGEVKEEEKRAIGSILGALAKGLPTL ISWIKNRG |
| Length | 68 |
| Signal peptide class | Class-1 |
| References: | |
| 1. for MIC/HC50 | E. Urban et al. / International Journal of Antimicrobial agents 29 (2007) 317-321. Activities of four frog skin-derived antimicrobial peptides (temporin-1DRa, temporin-1Va and the melittin-related peptides AR-23 and RV-23) against anaerobic bacteria |
| 2. for other activities | J.M. Conlon et al. / Biochemical and Biophysical Research Communications 306 (2003) 496-500. A melittin-related peptide from the skin of the Japanese frog, Rana tagoi, with antimicrobial and cytolytic properties |
| Segment type | Name | Length | Amidated | Sequence | HC50 (μM) | MIC E. coli (μM) | MIC S. aureus (μM) |
| Signal | 22 | MFTLKKSMLLLFFLGTISFSLC | |||||
| Prepro | 22 | QEERDANEEEENGGEVKEEEKR | |||||
| Bioactive | Prepromelittin-related peptide | 23 | Yes | AIGSILGALAKGLPTLISWIKNR | 8 | 12.5 | 6 |