| Entry | Preprobradykinin-1 |
| Uniprot code | A0AEI1 |
| Fasta | A0AEI1 |
| Peptide names | V1,T6 bradykinin Preprobradykinin-1 V1-bradykinin |
| Suborder | Neobatrachia |
| Family | Ranidae |
| Genus | Hylarana |
| Species | Hylarana guentheri |
| Ecozone | Indomalaya |
| Distribution | Central Vietnam throughout southern China (north to Yangtze River), including Hainan and Taiwan; introduced onto Guam |
| Antimicrobial & other activities | contraction of small intestine smooth muscle cells, relaxation of arterial smooth muscle cells |
| Tissue | Skin, Venom |
| Sequence | MLTLKKSLLLLFFFGTISLSLCEQERDADEDENESRTVRVPPGFTPFRIAPASSLKRNAD ADETERRISKRPPGFSPFRIAPASSLKRNADADETERRISKRPPGFSPFRIAPASSLKRN ADADETERRISKRPPGFSPFRIAPASSLKRNADEDENESRMVRVPPGFSPFRIAPEIV |
| Length | 178 |
| Signal peptide class | Class-1 |
| References: | |
| 2. for other activities | T. Chen et al. / Peptides 23 (2002) 1547-1555. Bradykinins and their precursor cDNAs from the skin of the fire-bellied toad (Bombina orientalis) |
| Segment type | Name | Length | Amidated | Sequence | HC50 (μM) | MIC E. coli (μM) | MIC S. aureus (μM) |
| Signal | 22 | MLTLKKSLLLLFFFGTISLSLC | |||||
| Prepro | 17 | EQERDADEDENESRTVR | |||||
| Bioactive | V1,T6 bradykinin | 9 | No | VPPGFTPFR | |||
| Prepro | 22 | IAPASSLKRNADADETERRISK | |||||
| Bioactive | bradykinin | 9 | No | RPPGFSPFR | |||
| Prepro | 22 | IAPASSLKRNADADETERRISK | |||||
| Bioactive | bradykinin | 9 | No | RPPGFSPFR | |||
| Prepro | 22 | IAPASSLKRNADADETERRISK | |||||
| Bioactive | bradykinin | 9 | No | RPPGFSPFR | |||
| Prepro | 22 | IAPASSLKRNADEDENESRMVR | |||||
| Bioactive | V1-bradykinin | 9 | No | VPPGFSPFR |