| Entry |
Amurin-2 |
| Uniprot code |
A0AAS2 |
| Fasta |
A0AAS2 |
| Peptide names |
Amurin-2 Brevinin-1PRa Brevinin-1CDYa Brevinin-1DYb |
| Suborder |
Neobatrachia |
| Family |
Ranidae |
| Genus |
Rana |
| Species |
Rana amurensis |
| Ecozone |
Palearctic |
| Distribution |
Western Siberia east to Sakhalin Island, northern and eastern Mongolia, northeastern China and North Korea, north to beyond the Arctic Circle (northernmost 71 degrees N) |
| Antimicrobial & other activities |
antibacterial, antifungal |
| Tissue |
Skin |
| Sequence |
MFTLKKSLLLLFFLGTINLSLCEEERNADEEERRDDLEERDVEVEKRFLSLALAALPKLF
CLIFKKC
|
| Length |
67 |
| Signal peptide class |
Class-1 |
| References: |
| 1. for MIC/HC50 |
J.M. Conlon et al. / Regulatory Peptides 118 (2004) 135-141. A family of brevinin-2 peptides with potent activity against Pseudomonas aeruginosa from the skin of the Hokkaido frog, Rana pirica |